GRPEL2 antibody (70R-2426)

Rabbit polyclonal GRPEL2 antibody

Synonyms Polyclonal GRPEL2 antibody, Anti-GRPEL2 antibody, Grpe-Like 2 Mitochondrial antibody, FLJ23713 antibody, Mt-GrpE#2 antibody, FLJ33918 antibody, DKFZp451C205 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
Assay Information GRPEL2 Blocking Peptide, catalog no. 33R-3717, is also available for use as a blocking control in assays to test for specificity of this GRPEL2 antibody


Western Blot analysis using GRPEL2 antibody (70R-2426)

GRPEL2 antibody (70R-2426) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRPEL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GRPEL2 antibody (70R-2426) | GRPEL2 antibody (70R-2426) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors