GSPT2 antibody (70R-5565)

Rabbit polyclonal GSPT2 antibody raised against the N terminal of GSPT2

Synonyms Polyclonal GSPT2 antibody, Anti-GSPT2 antibody, GST2 antibody, FLJ10441 antibody, G1 To S Phase Transition 2 antibody, eRF3b antibody
Specificity GSPT2 antibody was raised against the N terminal of GSPT2
Cross Reactivity Human
Applications WB
Immunogen GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI
Assay Information GSPT2 Blocking Peptide, catalog no. 33R-5685, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody


Western Blot analysis using GSPT2 antibody (70R-5565)

GSPT2 antibody (70R-5565) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSPT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSPT2 antibody (70R-5565) | GSPT2 antibody (70R-5565) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors