GSTK1 antibody (70R-4024)

Rabbit polyclonal GSTK1 antibody raised against the middle region of GSTK1

Synonyms Polyclonal GSTK1 antibody, Anti-GSTK1 antibody, GSTK 1, GSTK 1 antibody, GSTK1, Glutathione S-Transferase Kappa 1 antibody, GSTK-1 antibody, GSTK-1, GST13 antibody
Specificity GSTK1 antibody was raised against the middle region of GSTK1
Cross Reactivity Human
Applications WB
Immunogen GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL
Assay Information GSTK1 Blocking Peptide, catalog no. 33R-6755, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody

Images

Western Blot analysis using GSTK1 antibody (70R-4024)

GSTK1 antibody (70R-4024) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GSTK1 antibody (70R-4024) | GSTK1 antibody (70R-4024) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors