GSTT1 antibody (70R-2157)

Rabbit polyclonal GSTT1 antibody raised against the C terminal of GSTT1

Synonyms Polyclonal GSTT1 antibody, Anti-GSTT1 antibody, GSTT-1 antibody, GSTT1, GSTT 1 antibody, GSTT 1, GSTT-1, Glutathione S-Transferase Theta 1 antibody
Specificity GSTT1 antibody was raised against the C terminal of GSTT1
Cross Reactivity Human
Applications WB
Immunogen GSTT1 antibody was raised using the C terminal of GSTT1 corresponding to a region with amino acids TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Assay Information GSTT1 Blocking Peptide, catalog no. 33R-9381, is also available for use as a blocking control in assays to test for specificity of this GSTT1 antibody


Western Blot analysis using GSTT1 antibody (70R-2157)

GSTT1 antibody (70R-2157) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GSTT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GSTT1 antibody (70R-2157) | GSTT1 antibody (70R-2157) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors