GTPBP9 antibody (70R-1417)

Rabbit polyclonal GTPBP9 antibody

Synonyms Polyclonal GTPBP9 antibody, Anti-GTPBP9 antibody, GTPBP 9, GTPBP9, GTPBP-9 antibody, Gtp-Binding Protein 9 antibody, GTPBP 9 antibody, GTPBP-9
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND
Assay Information GTPBP9 Blocking Peptide, catalog no. 33R-6110, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Images

Western Blot analysis using GTPBP9 antibody (70R-1417)

GTPBP9 antibody (70R-1417) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GTPBP9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GTPBP9 antibody (70R-1417) | GTPBP9 antibody (70R-1417) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors