GTPBP9 antibody (70R-4825)

Rabbit polyclonal GTPBP9 antibody

Synonyms Polyclonal GTPBP9 antibody, Anti-GTPBP9 antibody, GTPBP 9, GTPBP 9 antibody, GTPBP-9, GTPBP-9 antibody, Gtp-Binding Protein 9 antibody, GTPBP9
Cross Reactivity Human, Mouse, Rat, Drosophila, Zebra Fish
Applications WB
Immunogen GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE
Assay Information GTPBP9 Blocking Peptide, catalog no. 33R-7451, is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody


Western Blot analysis using GTPBP9 antibody (70R-4825)

GTPBP9 antibody (70R-4825) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GTPBP9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GTPBP9 antibody (70R-4825) | GTPBP9 antibody (70R-4825) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors