GUK1 antibody (70R-2009)

Rabbit polyclonal GUK1 antibody raised against the middle region of GUK1

Synonyms Polyclonal GUK1 antibody, Anti-GUK1 antibody, Guanylate Kinase 1 antibody, GMK antibody
Specificity GUK1 antibody was raised against the middle region of GUK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI
Assay Information GUK1 Blocking Peptide, catalog no. 33R-3939, is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody


Western Blot analysis using GUK1 antibody (70R-2009)

GUK1 antibody (70R-2009) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GUK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GUK1 is essential for recycling GMP and indirectly, cGMP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GUK1 antibody (70R-2009) | GUK1 antibody (70R-2009) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors