H2AFY antibody (70R-2114)

Rabbit polyclonal H2AFY antibody raised against the middle region of H2AFY

Synonyms Polyclonal H2AFY antibody, Anti-H2AFY antibody, HAF 2, H2AF, HAF-2, macroH2A1.2 antibody, H2A/y antibody, H2AFJ antibody, mH2A1 antibody, H2A Histone Y antibody, HAF-2 antibody, H2AF12M antibody, H2A.y antibody, HAF 2 antibody, MACROH2A1.1 antibody
Specificity H2AFY antibody was raised against the middle region of H2AFY
Cross Reactivity Human,Rat
Applications WB
Immunogen H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG
Assay Information H2AFY Blocking Peptide, catalog no. 33R-7423, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Western Blot analysis using H2AFY antibody (70R-2114)

H2AFY antibody (70R-2114) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of H2AFY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using H2AFY antibody (70R-2114) | H2AFY antibody (70R-2114) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors