H2AFY antibody (70R-2126)

Rabbit polyclonal H2AFY antibody raised against the N terminal of H2AFY

Synonyms Polyclonal H2AFY antibody, Anti-H2AFY antibody, HAF 2 antibody, H2A.y antibody, H2AF, H2AFJ antibody, HAF-2, macroH2A1.2 antibody, H2A/y antibody, MACROH2A1.1 antibody, H2A Histone Y antibody, H2AF12M antibody, HAF-2 antibody, HAF 2, mH2A1 antibody
Specificity H2AFY antibody was raised against the N terminal of H2AFY
Cross Reactivity Human
Applications WB
Immunogen H2AFY antibody was raised using the N terminal of H2AFY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA
Assay Information H2AFY Blocking Peptide, catalog no. 33R-6507, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Images

Western Blot analysis using H2AFY antibody (70R-2126)

H2AFY antibody (70R-2126) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of H2AFY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using H2AFY antibody (70R-2126) | H2AFY antibody (70R-2126) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors