H6PD antibody (70R-5347)

Rabbit polyclonal H6PD antibody

Synonyms Polyclonal H6PD antibody, Anti-H6PD antibody, DKFZp686A01246 antibody, GDH antibody, Hexose-6-Phosphate Dehydrogenase antibody, HPD-6, HPD-6 antibody, H6PD, MGC87643 antibody, G6PDH antibody, Glucose 1-Dehydrogenase antibody, HPD 6, HPD 6 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen H6PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
Assay Information H6PD Blocking Peptide, catalog no. 33R-3729, is also available for use as a blocking control in assays to test for specificity of this H6PD antibody

Images

Western Blot analysis using H6PD antibody (70R-5347)

H6PD antibody (70R-5347) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of H6PD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using H6PD antibody (70R-5347) | H6PD antibody (70R-5347) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors