HAGH antibody (70R-3635)

Rabbit polyclonal HAGH antibody raised against the C terminal of HAGH

Synonyms Polyclonal HAGH antibody, Anti-HAGH antibody, GLO2 antibody, HAGH1 antibody, Hydroxyacylglutathione Hydrolase antibody, GLXII antibody, GLX2 antibody
Specificity HAGH antibody was raised against the C terminal of HAGH
Cross Reactivity Human
Applications WB
Immunogen HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT
Assay Information HAGH Blocking Peptide, catalog no. 33R-2847, is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Images

Western Blot analysis using HAGH antibody (70R-3635)

HAGH antibody (70R-3635) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAGH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HAGH antibody (70R-3635) | HAGH antibody (70R-3635) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors