HBXIP antibody (70R-2217)

Rabbit polyclonal HBXIP antibody raised against the N terminal of HBXIP

Synonyms Polyclonal HBXIP antibody, Anti-HBXIP antibody, MGC71071 antibody, XIP antibody, Hepatitis B Virus X Interacting Protein antibody
Specificity HBXIP antibody was raised against the N terminal of HBXIP
Cross Reactivity Human
Applications WB
Immunogen HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR
Assay Information HBXIP Blocking Peptide, catalog no. 33R-2632, is also available for use as a blocking control in assays to test for specificity of this HBXIP antibody

Images

Western Blot analysis using HBXIP antibody (70R-2217)

HBXIP antibody (70R-2217) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HBXIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HBXIP antibody (70R-2217) | HBXIP antibody (70R-2217) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors