HCFC1R1 antibody (70R-2181)

Rabbit polyclonal HCFC1R1 antibody

Synonyms Polyclonal HCFC1R1 antibody, Anti-HCFC1R1 antibody, Host Cell Factor C1 Regulator 1 antibody, HPIP antibody, MGC70711 antibody, MGC99622 antibody, FLJ20568 antibody
Cross Reactivity Human
Applications WB
Immunogen HCFC1R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM
Assay Information HCFC1R1 Blocking Peptide, catalog no. 33R-5357, is also available for use as a blocking control in assays to test for specificity of this HCFC1R1 antibody


Western Blot analysis using HCFC1R1 antibody (70R-2181)

HCFC1R1 antibody (70R-2181) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HCFC1R1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HCFC1R1 antibody (70R-2181) | HCFC1R1 antibody (70R-2181) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors