HDDC3 antibody (70R-4274)

Rabbit polyclonal HDDC3 antibody raised against the middle region of HDDC3

Synonyms Polyclonal HDDC3 antibody, Anti-HDDC3 antibody, HDDC3, HDDC-3 antibody, HDDC-3, Hd Domain Containing 3 antibody, HDDC 3 antibody, MGC45386 antibody, HDDC 3
Specificity HDDC3 antibody was raised against the middle region of HDDC3
Cross Reactivity Human,Mouse
Applications WB
Immunogen HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI
Assay Information HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Images

Western Blot analysis using HDDC3 antibody (70R-4274)

HDDC3 antibody (70R-4274) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDDC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HDDC3 antibody (70R-4274) | HDDC3 antibody (70R-4274) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors