HECA antibody (70R-5536)

Rabbit polyclonal HECA antibody

Synonyms Polyclonal HECA antibody, Anti-HECA antibody, dJ225E12.1 antibody, Headcase Homolog antibody, HHDC antibody, HDCL antibody, HDC antibody
Cross Reactivity Human
Applications WB
Immunogen HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF
Assay Information HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody

Images

Western Blot analysis using HECA antibody (70R-5536)

HECA antibody (70R-5536) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HECA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HECA antibody (70R-5536) | HECA antibody (70R-5536) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors