Hemoglobin Zeta antibody (70R-1234)

Rabbit polyclonal Hemoglobin Zeta antibody raised against the N terminal of HBZ

Synonyms Polyclonal Hemoglobin Zeta antibody, Anti-Hemoglobin Zeta antibody, HBZ antibody
Specificity Hemoglobin Zeta antibody was raised against the N terminal of HBZ
Cross Reactivity Human
Applications IHC, WB
Immunogen Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
Assay Information Hemoglobin Zeta Blocking Peptide, catalog no. 33R-2702, is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody

Images

Western Blot analysis using Hemoglobin Zeta antibody (70R-1234)

Hemoglobin Zeta antibody (70R-1234) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HBZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Hemoglobin Zeta antibody (70R-1234) | Hemoglobin Zeta antibody (70R-1234) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
OR
Shipping
View Our Distributors