HERC5 antibody (70R-5524)

Rabbit polyclonal HERC5 antibody raised against the N terminal of HERC5

Synonyms Polyclonal HERC5 antibody, Anti-HERC5 antibody, CEBP1 antibody, Hect Domain And Rld 5 antibody, CEB1 antibody
Specificity HERC5 antibody was raised against the N terminal of HERC5
Cross Reactivity Human
Applications WB
Immunogen HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ
Assay Information HERC5 Blocking Peptide, catalog no. 33R-1749, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody


Western Blot analysis using HERC5 antibody (70R-5524)

HERC5 antibody (70R-5524) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HERC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HERC5 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HERC5 antibody (70R-5524) | HERC5 antibody (70R-5524) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors