HERC5 antibody (70R-5525)

Rabbit polyclonal HERC5 antibody raised against the middle region of HERC5

Synonyms Polyclonal HERC5 antibody, Anti-HERC5 antibody, Hect Domain And Rld 5 antibody, CEBP1 antibody, CEB1 antibody
Specificity HERC5 antibody was raised against the middle region of HERC5
Cross Reactivity Human
Applications WB
Immunogen HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
Assay Information HERC5 Blocking Peptide, catalog no. 33R-2921, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody


Western Blot analysis using HERC5 antibody (70R-5525)

HERC5 antibody (70R-5525) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HERC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HERC5 antibody (70R-5525) | HERC5 antibody (70R-5525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors