HEXIM2 antibody (70R-4973)

Rabbit polyclonal HEXIM2 antibody raised against the N terminal of HEXIM2

Synonyms Polyclonal HEXIM2 antibody, Anti-HEXIM2 antibody, L3 antibody, Hexamthylene Bis-Acetamide Inducible 2 antibody, FLJ32384 antibody
Specificity HEXIM2 antibody was raised against the N terminal of HEXIM2
Cross Reactivity Human
Applications WB
Immunogen HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
Assay Information HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody

Images

Western Blot analysis using HEXIM2 antibody (70R-4973)

HEXIM2 antibody (70R-4973) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEXIM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HEXIM2 antibody (70R-4973) | HEXIM2 antibody (70R-4973) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors