HEY1 antibody (70R-5241)

Rabbit polyclonal HEY1 antibody raised against the middle region of HEY1

Synonyms Polyclonal HEY1 antibody, Anti-HEY1 antibody, OAF1 antibody, HERP2 antibody, HRT-1 antibody, MGC1274 antibody, Hairy/Enhancer-Of-Split Related With Yrpw Motif 1 antibody, CHF2 antibody, HESR1 antibody
Specificity HEY1 antibody was raised against the middle region of HEY1
Cross Reactivity Human
Applications WB
Immunogen HEY1 antibody was raised using the middle region of HEY1 corresponding to a region with amino acids HQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAF
Assay Information HEY1 Blocking Peptide, catalog no. 33R-3822, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Images

Western blot analysis using HEY1 antibody (70R-5241)

Recommended HEY1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using HEY1 antibody (70R-5241) | Recommended HEY1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors