HINT1 antibody (70R-4222)

Rabbit polyclonal HINT1 antibody raised against the N terminal of HINT1

Synonyms Polyclonal HINT1 antibody, Anti-HINT1 antibody, PRKCNH1 antibody, PKCI-1 antibody, HINT 1 antibody, HINT antibody, HINT-1, FLJ32340 antibody, FLJ30414 antibody, Histidine Triad Nucleotide Binding Protein 1 antibody, HINT1, HINT-1 antibody, HINT 1
Specificity HINT1 antibody was raised against the N terminal of HINT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD
Assay Information HINT1 Blocking Peptide, catalog no. 33R-1729, is also available for use as a blocking control in assays to test for specificity of this HINT1 antibody

Images

Western blot analysis using HINT1 antibody (70R-4222)

Tissue analyzed: Human Jurkat; Antibody Dilution: 1.0ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HINT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using HINT1 antibody (70R-4222) | Tissue analyzed: Human Jurkat; Antibody Dilution: 1.0ug/ml
  • Immunofluorescent staining using HINT1 antibody (70R-4222) | Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue.; Observed Staining: Cytoplasm of bronchial epithelial tissue stained with HINT antibody at 1:100
  • Western blot analysis using HINT1 antibody (70R-4222) | Recommended HINT1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using HINT1 antibody (70R-4222) | Kidney

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors