HIPK1 antibody (70R-2078)

Rabbit polyclonal HIPK1 antibody raised against the middle region of HIPK1

Synonyms Polyclonal HIPK1 antibody, Anti-HIPK1 antibody, Homeodomain Interacting Protein Kinase 1 antibody, HIPK1, Nbak2 antibody, Myak antibody, HIPK 1 antibody, HIPK-1 antibody, HIPK 1, KIAA0630 antibody, HIPK-1, MGC33446 antibody, MGC33548 antibody, MGC26642 antibody
Specificity HIPK1 antibody was raised against the middle region of HIPK1
Cross Reactivity Human
Applications WB
Immunogen HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
Assay Information HIPK1 Blocking Peptide, catalog no. 33R-7200, is also available for use as a blocking control in assays to test for specificity of this HIPK1 antibody


Western Blot analysis using HIPK1 antibody (70R-2078)

HIPK1 antibody (70R-2078) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 131 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HIPK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HIPK1 antibody (70R-2078) | HIPK1 antibody (70R-2078) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors