HLA-DQA2 antibody (70R-4489)

Rabbit polyclonal HLA-DQA2 antibody raised against the middle region of HLA-DQA2

Synonyms Polyclonal HLA-DQA2 antibody, Anti-HLA-DQA2 antibody, DQ alpha antibody, HLA-DXA antibody, Major Histocompatibility Complex Class Ii Dq Alpha 2 antibody
Specificity HLA-DQA2 antibody was raised against the middle region of HLA-DQA2
Cross Reactivity Human
Applications WB
Immunogen HLA-DQA2 antibody was raised using the middle region of HLA-DQA2 corresponding to a region with amino acids LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
Assay Information HLA-DQA2 Blocking Peptide, catalog no. 33R-5275, is also available for use as a blocking control in assays to test for specificity of this HLA-DQA2 antibody


Western Blot analysis using HLA-DQA2 antibody (70R-4489)

HLA-DQA2 antibody (70R-4489) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HLA-DQA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognised by CD4 T-cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HLA-DQA2 antibody (70R-4489) | HLA-DQA2 antibody (70R-4489) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors