HMGCL antibody (70R-1589)

Rabbit polyclonal HMGCL antibody

Synonyms Polyclonal HMGCL antibody, Anti-HMGCL antibody, Hydroxymethylglutaricaciduria antibody, 3-Hydroxymethyl-3-Methylglutaryl-Coenzyme A Lyase antibody, HL antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
Assay Information HMGCL Blocking Peptide, catalog no. 33R-10034, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody

Images

Western Blot analysis using HMGCL antibody (70R-1589)

HMGCL antibody (70R-1589) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HMGCL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HMGCL antibody (70R-1589) | HMGCL antibody (70R-1589) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors