HMGCS1 antibody (70R-2381)

Rabbit polyclonal HMGCS1 antibody

Synonyms Polyclonal HMGCS1 antibody, Anti-HMGCS1 antibody, HMGCS antibody, MGC90332 antibody, 3-Hydroxy-3-Methylglutaryl-Coenzyme A Synthase 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
Assay Information HMGCS1 Blocking Peptide, catalog no. 33R-4286, is also available for use as a blocking control in assays to test for specificity of this HMGCS1 antibody


Immunohistochemical staining using HMGCS1 antibody (70R-2381)

HMGCS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMGCS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HMGCS1 antibody (70R-2381) | HMGCS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using HMGCS1 antibody (70R-2381) | HMGCS1 antibody (70R-2381) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors