HNRPA0 antibody (70R-1363)

Rabbit polyclonal HNRPA0 antibody raised against the middle region of HNRPA0

Synonyms Polyclonal HNRPA0 antibody, Anti-HNRPA0 antibody, Heterogeneous Nuclear Ribonucleoprotein A0 antibody
Specificity HNRPA0 antibody was raised against the middle region of HNRPA0
Cross Reactivity Human
Applications IHC, WB
Immunogen HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Assay Information HNRPA0 Blocking Peptide, catalog no. 33R-4234, is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody


Immunohistochemical staining using HNRPA0 antibody (70R-1363)

HNRPA0 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA0 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPA0 antibody (70R-1363) | HNRPA0 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using HNRPA0 antibody (70R-1363) | HNRPA0 antibody (70R-1363) used at 0.625 ug/ml to detect target protein.
  • Immunohistochemical staining using HNRPA0 antibody (70R-1363) | HNRPA0 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors