HNRPA1 antibody (70R-1313)

Rabbit polyclonal HNRPA1 antibody raised against the C terminal of HNRPA1

Synonyms Polyclonal HNRPA1 antibody, Anti-HNRPA1 antibody, HNRPA 1, HNRPA-1, HNRPA 1 antibody, HNRPA-1 antibody, Heterogeneous Nuclear Ribonucleoprotein A1 antibody, HNRPA1
Specificity HNRPA1 antibody was raised against the C terminal of HNRPA1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG
Assay Information HNRPA1 Blocking Peptide, catalog no. 33R-6846, is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody


Immunohistochemical staining using HNRPA1 antibody (70R-1313)

HNRPA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine . Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPA1 antibody (70R-1313) | HNRPA1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine . Magnification is at 400X
  • Western Blot analysis using HNRPA1 antibody (70R-1313) | HNRPA1 antibody (70R-1313) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors