HNRPA3 antibody (70R-1463)

Rabbit polyclonal HNRPA3 antibody raised against the N terminal of HNRPA3

Synonyms Polyclonal HNRPA3 antibody, Anti-HNRPA3 antibody, HNRPA3, HNRPA 3 antibody, HNRPA-3 antibody, HNRPA 3, Heterogeneous Nuclear Ribonucleoprotein A3 antibody, HNRPA-3
Specificity HNRPA3 antibody was raised against the N terminal of HNRPA3
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Assay Information HNRPA3 Blocking Peptide, catalog no. 33R-5978, is also available for use as a blocking control in assays to test for specificity of this HNRPA3 antibody


Immunohistochemical staining using HNRPA3 antibody (70R-1463)

HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPA3 antibody (70R-1463) | HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using HNRPA3 antibody (70R-1463) | HNRPA3 antibody (70R-1463) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using HNRPA3 antibody (70R-1463) | HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors