HNRPC antibody (70R-4661)

Rabbit polyclonal HNRPC antibody

Synonyms Polyclonal HNRPC antibody, Anti-HNRPC antibody, C2 antibody, HNRNP antibody, hnRNPC antibody, MGC104306 antibody, C1/C2 antibody, MGC105117 antibody, Heterogeneous Nuclear Ribonucleoprotein C antibody, MGC131677 antibody, C1 antibody, MGC117353 antibody, SNRPC antibody
Cross Reactivity Human
Applications WB
Immunogen HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ
Assay Information HNRPC Blocking Peptide, catalog no. 33R-4848, is also available for use as a blocking control in assays to test for specificity of this HNRPC antibody

Images

Western Blot analysis using HNRPC antibody (70R-4661)

HNRPC antibody (70R-4661) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HNRPC antibody (70R-4661) | HNRPC antibody (70R-4661) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors