HRG antibody (70R-5293)

Rabbit polyclonal HRG antibody raised against the middle region of HRG

Synonyms Polyclonal HRG antibody, Anti-HRG antibody, DKFZp779H1622 antibody, HPRG antibody, Histidine-Rich Glycoprotein antibody, HRGP antibody
Specificity HRG antibody was raised against the middle region of HRG
Cross Reactivity Human
Applications WB
Immunogen HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG
Assay Information HRG Blocking Peptide, catalog no. 33R-3749, is also available for use as a blocking control in assays to test for specificity of this HRG antibody


Western Blot analysis using HRG antibody (70R-5293)

HRG antibody (70R-5293) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HRG antibody (70R-5293) | HRG antibody (70R-5293) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors