HRSP12 antibody (70R-4592)

Rabbit polyclonal HRSP12 antibody raised against the N terminal of HRSP12

Synonyms Polyclonal HRSP12 antibody, Anti-HRSP12 antibody, HRSP12, UK114 antibody, P14.5 antibody, HRSP 12, HRSP 12 antibody, PSP antibody, Heat-Responsive Protein 12 antibody, HRSP-12 antibody, HRSP-12
Specificity HRSP12 antibody was raised against the N terminal of HRSP12
Cross Reactivity Human
Applications WB
Immunogen HRSP12 antibody was raised using the N terminal of HRSP12 corresponding to a region with amino acids MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG
Assay Information HRSP12 Blocking Peptide, catalog no. 33R-6500, is also available for use as a blocking control in assays to test for specificity of this HRSP12 antibody


Western Blot analysis using HRSP12 antibody (70R-4592)

HRSP12 antibody (70R-4592) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HRSP12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HRSP12 is an endoribonuclease responsible for the inhibition of the translation by cleaving mRNA.HRSP12 inhibits cell-free protein synthesis. HRSP12 cleaves phosphodiester bonds only in single-stranded RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HRSP12 antibody (70R-4592) | HRSP12 antibody (70R-4592) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors