HS3ST1 antibody (70R-5492)

Rabbit polyclonal HS3ST1 antibody

Synonyms Polyclonal HS3ST1 antibody, Anti-HS3ST1 antibody, Heparan Sulfate antibody, 3OST1 antibody, 3OST antibody, Glucosamine 3-O-Sulfotransferase 1 antibody
Cross Reactivity Human
Applications WB
Immunogen HS3ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
Assay Information HS3ST1 Blocking Peptide, catalog no. 33R-9139, is also available for use as a blocking control in assays to test for specificity of this HS3ST1 antibody


Western Blot analysis using HS3ST1 antibody (70R-5492)

HS3ST1 antibody (70R-5492) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HS3ST1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HS3ST1 antibody (70R-5492) | HS3ST1 antibody (70R-5492) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors