HSD17B14 antibody (70R-4347)

Rabbit polyclonal HSD17B14 antibody

Synonyms Polyclonal HSD17B14 antibody, Anti-HSD17B14 antibody, Hydroxysteroid 17B14 antibody, DHRS10 antibody, retSDR3 antibody, 17-Beta Dehydrogenase 14 antibody
Cross Reactivity Human
Applications WB
Immunogen HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
Assay Information HSD17B14 Blocking Peptide, catalog no. 33R-8259, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody


Western Blot analysis using HSD17B14 antibody (70R-4347)

HSD17B14 antibody (70R-4347) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD17B14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSD17B14 antibody (70R-4347) | HSD17B14 antibody (70R-4347) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors