HSPA1L antibody (70R-4431)

Rabbit polyclonal HSPA1L antibody raised against the C terminal of HSPA1L

Synonyms Polyclonal HSPA1L antibody, Anti-HSPA1L antibody, hum70t antibody, HSP 70 antibody, Heat Shock 70Kda Protein 1-Like antibody, HSP-70, HSP70, HSP-70 antibody, HSP70-HOM antibody, HSP 70, HSP70 antibody
Specificity HSPA1L antibody was raised against the C terminal of HSPA1L
Cross Reactivity Human
Applications WB
Immunogen HSPA1L antibody was raised using the C terminal of HSPA1L corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Assay Information HSPA1L Blocking Peptide, catalog no. 33R-1900, is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody


Western Blot analysis using HSPA1L antibody (70R-4431)

HSPA1L antibody (70R-4431) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSPA1L antibody (70R-4431) | HSPA1L antibody (70R-4431) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors