HSPA4 antibody (70R-2281)

Rabbit polyclonal HSPA4 antibody raised against the middle region of HSPA4

Synonyms Polyclonal HSPA4 antibody, Anti-HSPA4 antibody, HS24/P52 antibody, APG-2 antibody, HSP70, HSP 70 antibody, Heat Shock 70Kda Protein 4 antibody, HSP 70, hsp70 antibody, RY antibody, hsp70RY antibody, HSP70 antibody, HSP-70 antibody, HSP-70, MGC131852 antibody
Specificity HSPA4 antibody was raised against the middle region of HSPA4
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
Assay Information HSPA4 Blocking Peptide, catalog no. 33R-7155, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Images

Western Blot analysis using HSPA4 antibody (70R-2281)

HSPA4 antibody (70R-2281) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HSPA4 antibody (70R-2281) | HSPA4 antibody (70R-2281) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors