HSPB8 antibody (70R-2327)

Rabbit polyclonal HSPB8 antibody raised against the middle region of HSPB8

Synonyms Polyclonal HSPB8 antibody, Anti-HSPB8 antibody, Heat Shock 22Kda Protein 8 antibody, HSP-22, H11 antibody, HSP22 antibody, HMN2A antibody, HSP 22, HSP-22 antibody, DHMN2 antibody, HSP22 antibody, CMT2L antibody, HSP 22 antibody, HSP22, E2IG1 antibody, HMN2 antibody
Specificity HSPB8 antibody was raised against the middle region of HSPB8
Cross Reactivity Human
Applications WB
Immunogen HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
Assay Information HSPB8 Blocking Peptide, catalog no. 33R-7039, is also available for use as a blocking control in assays to test for specificity of this HSPB8 antibody

Images

Western Blot analysis using HSPB8 antibody (70R-2327)

HSPB8 antibody (70R-2327) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPB8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HSPB8 antibody (70R-2327) | HSPB8 antibody (70R-2327) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £300.47
Size: 50 ug
OR
Shipping
View Our Distributors