ICA1 antibody (70R-3830)

Rabbit polyclonal ICA1 antibody raised against the C terminal of ICA1

Synonyms Polyclonal ICA1 antibody, Anti-ICA1 antibody, ICA 1 antibody, ICA1, ICA 1, ICA69 antibody, ICA-1, ICAp69 antibody, Islet Cell Autoantigen 1 69Kda antibody, ICA-1 antibody
Specificity ICA1 antibody was raised against the C terminal of ICA1
Cross Reactivity Human,Mouse
Applications WB
Immunogen ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
Assay Information ICA1 Blocking Peptide, catalog no. 33R-6795, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody


Western Blot analysis using ICA1 antibody (70R-3830)

ICA1 antibody (70R-3830) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ICA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ICA1 antibody (70R-3830) | ICA1 antibody (70R-3830) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors