IDH2 antibody (70R-2523)

Rabbit polyclonal IDH2 antibody

Synonyms Polyclonal IDH2 antibody, Anti-IDH2 antibody, Isocitrate Dehydrogenase 2 antibody, IDH2, mNADP-IDH antibody, IDP antibody, IDH antibody, ICD-M antibody, IDHM antibody, IDH-2 antibody, IDH-2, IDH 2, IDH 2 antibody, Nadp+ Mitochondrial antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK
Assay Information IDH2 Blocking Peptide, catalog no. 33R-3304, is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Western Blot analysis using IDH2 antibody (70R-2523)

IDH2 antibody (70R-2523) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IDH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using IDH2 antibody (70R-2523) | IDH2 antibody (70R-2523) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors