IER5 antibody (70R-2561)

Rabbit polyclonal IER5 antibody raised against the N terminal of IER5

Synonyms Polyclonal IER5 antibody, Anti-IER5 antibody, IER-5 antibody, IER 5, MGC102760 antibody, IER5, SBBI48 antibody, Immediate Early Response 5 antibody, IER-5, IER 5 antibody
Specificity IER5 antibody was raised against the N terminal of IER5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD
Assay Information IER5 Blocking Peptide, catalog no. 33R-5913, is also available for use as a blocking control in assays to test for specificity of this IER5 antibody


Western Blot analysis using IER5 antibody (70R-2561)

IER5 antibody (70R-2561) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IER5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IER5 antibody (70R-2561) | IER5 antibody (70R-2561) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors