IFI35 antibody (70R-1979)

Rabbit polyclonal IFI35 antibody raised against the N terminal of IFI35

Synonyms Polyclonal IFI35 antibody, Anti-IFI35 antibody, IFI35, IFI 35 antibody, FLJ21753 antibody, IFP35 antibody, IFI-35 antibody, IFI 35, Interferon-Induced Protein 35 antibody, IFI-35
Specificity IFI35 antibody was raised against the N terminal of IFI35
Cross Reactivity Human
Applications WB
Immunogen IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL
Assay Information IFI35 Blocking Peptide, catalog no. 33R-6397, is also available for use as a blocking control in assays to test for specificity of this IFI35 antibody


Western Blot analysis using IFI35 antibody (70R-1979)

IFI35 antibody (70R-1979) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFI35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFI35 has been shown to interact with NMI and BATF.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IFI35 antibody (70R-1979) | IFI35 antibody (70R-1979) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors