IFI44L antibody (70R-1290)

Rabbit polyclonal IFI44L antibody raised against the N terminal of IFI44L

Synonyms Polyclonal IFI44L antibody, Anti-IFI44L antibody, IFI 44, Interferon-Induced Protein 44-Like antibody, IFI-44, IFI44, IFI 44 antibody, GS3686 antibody, IFI-44 antibody, C1orf29 antibody
Specificity IFI44L antibody was raised against the N terminal of IFI44L
Cross Reactivity Human
Applications IHC, WB
Immunogen IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Assay Information IFI44L Blocking Peptide, catalog no. 33R-5983, is also available for use as a blocking control in assays to test for specificity of this IFI44L antibody


Immunohistochemical staining using IFI44L antibody (70R-1290)

IFI44L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IFI44L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this gene remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using IFI44L antibody (70R-1290) | IFI44L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using IFI44L antibody (70R-1290) | IFI44L antibody (70R-1290) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using IFI44L antibody (70R-1290) | IFI44L antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors