IFIH1 antibody (70R-4787)

Rabbit polyclonal IFIH1 antibody raised against the middle region of IFIH1

Synonyms Polyclonal IFIH1 antibody, Anti-IFIH1 antibody, MGC133047 antibody, Hlcd antibody, MDA-5 antibody, IFIH1, IFIH 1 antibody, Interferon Induced With Helicase C Domain 1 antibody, IFIH-1, MDA5 antibody, IFIH-1 antibody, IFIH 1, IDDM19 antibody
Specificity IFIH1 antibody was raised against the middle region of IFIH1
Cross Reactivity Human
Applications IHC, WB
Immunogen IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
Assay Information IFIH1 Blocking Peptide, catalog no. 33R-7591, is also available for use as a blocking control in assays to test for specificity of this IFIH1 antibody

Images

WB analysis of IFIH1 antibody (70R-7787)

Western Blot of IFIH1 antibody at 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFIH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • WB analysis of IFIH1 antibody (70R-7787) | Western Blot of IFIH1 antibody at 0.2-1 ug/ml
  • Immunohitochemical staining using IFIH1 antibody (70R-4787) | Immunohistochemical analysis of paraffin embedded spleen tissue, tested with an antibody Dilution of 5 ug/ml.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors