IFN Beta 1 antibody (70R-4521)

Rabbit polyclonal IFN Beta 1 antibody raised against the middle region of IFNB1

Synonyms Polyclonal IFN Beta 1 antibody, Anti-IFN Beta 1 antibody, IFB antibody, IFNB antibody, IFF antibody, MGC96956 antibody, Interferon Beta 1 Fibroblast antibody, IFNB1 antibody
Specificity IFN Beta 1 antibody was raised against the middle region of IFNB1
Cross Reactivity Human
Applications WB
Immunogen IFN Beta 1 antibody was raised using the middle region of IFNB1 corresponding to a region with amino acids NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKA
Assay Information IFN Beta 1 Blocking Peptide, catalog no. 33R-6764, is also available for use as a blocking control in assays to test for specificity of this IFN Beta 1 antibody

Images

Western Blot analysis using IFN Beta 1 antibody (70R-4521)

IFN Beta 1 antibody (70R-4521) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFNB1 has antiviral, antibacterial and anticancer activities.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFN Beta 1 antibody (70R-4521) | IFN Beta 1 antibody (70R-4521) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
OR
Shipping
View Our Distributors