IGF2BP1 antibody (70R-4908)

Rabbit polyclonal IGF2BP1 antibody raised against the N terminal of IGF2BP1

Synonyms Polyclonal IGF2BP1 antibody, Anti-IGF2BP1 antibody, VIon ChannelKZ1 antibody, IGF 2 antibody, CRD-BP antibody, ZBP1 antibody, IMP1 antibody, IGF 2, IGF-2, IGF-2 antibody, IGF2, IMP-1 antibody, Insulin-Like Growth Factor 2 mRNA Binding Protein 1 antibody, CRDBP antibody
Specificity IGF2BP1 antibody was raised against the N terminal of IGF2BP1
Cross Reactivity Human,Rat
Applications WB
Immunogen IGF2BP1 antibody was raised using the N terminal of IGF2BP1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT
Assay Information IGF2BP1 Blocking Peptide, catalog no. 33R-7007, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody


Western Blot analysis using IGF2BP1 antibody (70R-4908)

IGF2BP1 antibody (70R-4908) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGF2BP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IGF2BP1 antibody (70R-4908) | IGF2BP1 antibody (70R-4908) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors