IGFBP7 antibody (70R-5313)

Rabbit polyclonal IGFBP7 antibody raised against the C terminal of IGFBP7

Synonyms Polyclonal IGFBP7 antibody, Anti-IGFBP7 antibody, MAC25 antibody, IGFBP-7v antibody, IGFBP 7, IGFBP-7 antibody, IGFBP 7 antibody, Insulin-Like Growth Factor Binding Protein 7 antibody, PSF antibody, FSTL2 antibody, IGFBP7, IGFBP-7, IGFBP-7 antibody
Specificity IGFBP7 antibody was raised against the C terminal of IGFBP7
Cross Reactivity Human,Rat
Applications WB
Immunogen IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
Assay Information IGFBP7 Blocking Peptide, catalog no. 33R-7926, is also available for use as a blocking control in assays to test for specificity of this IGFBP7 antibody

Images

Western Blot analysis using IGFBP7 antibody (70R-5313)

IGFBP7 antibody (70R-5313) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFBP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IGFBP7 antibody (70R-5313) | IGFBP7 antibody (70R-5313) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors