IL10R Alpha antibody (70R-1865)

Rabbit polyclonal IL10R Alpha antibody raised against the N terminal of IL10RA

Synonyms Polyclonal IL10R Alpha antibody, Anti-IL10R Alpha antibody, IL10, IL-10, Interleukin 10 Receptor Alpha antibody, CDW210A antibody, IL10R antibody, HIL-10R antibody, IL-10 antibody, IL 10 antibody, IL10RA antibody, IL 10, IL-10R1 antibody
Specificity IL10R Alpha antibody was raised against the N terminal of IL10RA
Cross Reactivity Human
Applications WB
Immunogen IL10R Alpha antibody was raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Assay Information IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody

Images

Western Blot analysis using IL10R Alpha antibody (70R-1865)

IL10R Alpha antibody (70R-1865) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL10RA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IL10R Alpha antibody (70R-1865) | IL10R Alpha antibody (70R-1865) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors