IL13RA2 antibody (70R-1949)

Rabbit polyclonal IL13RA2 antibody raised against the N terminal of IL13RA2

Synonyms Polyclonal IL13RA2 antibody, Anti-IL13RA2 antibody, IL 13, IL13R Alpha 2 antibody, CD213A2 antibody, IL-13 antibody, IL 13 antibody, IL13BP antibody, IL13, Interleukin 13 Receptor Alpha 2 antibody, IL-13, IL-13R antibody
Specificity IL13RA2 antibody was raised against the N terminal of IL13RA2
Cross Reactivity Human,Dog
Applications WB
Immunogen IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
Assay Information IL13RA2 Blocking Peptide, catalog no. 33R-1973, is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody


Western Blot analysis using IL13RA2 antibody (70R-1949)

IL13RA2 antibody (70R-1949) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL13RA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IL13RA2 antibody (70R-1949) | IL13RA2 antibody (70R-1949) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors