IMP3 antibody (70R-4709)

Rabbit polyclonal IMP3 antibody

Synonyms Polyclonal IMP3 antibody, Anti-IMP3 antibody, FLJ10968 antibody, MRPS4 antibody, IMP 3 antibody, IMP-3 antibody, Imp3 U3 Small Nucleolar Ribonucleoprotein Homolog antibody, IMP-3, BRMS2 antibody, IMP 3, DKFZp586L0118 antibody, C15orf12 antibody, IMP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Assay Information IMP3 Blocking Peptide, catalog no. 33R-3318, is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody

Images

Immunohistochemical staining using IMP3 antibody (70R-4709)

IMP3 antibody staining. Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using IMP3 antibody (70R-4709) | IMP3 antibody staining. Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
  • Western blot analysis using IMP3 antibody (70R-4709) | Recommended IMP3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors