IMPDH1 antibody (70R-2055)

Rabbit polyclonal IMPDH1 antibody

Synonyms Polyclonal IMPDH1 antibody, Anti-IMPDH1 antibody, Imp antibody, IMPD1 antibody, IMPDH 1 antibody, DKFZp781N0678 antibody, LCA11 antibody, RP10 antibody, Inosine Monophosphate Dehydrogenase 1 antibody, sWSS2608 antibody, IMPDH 1, IMPDH-1, IMPD antibody, IMPDH1, IMPDH-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IMPDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
Assay Information IMPDH1 Blocking Peptide, catalog no. 33R-4468, is also available for use as a blocking control in assays to test for specificity of this IMPDH1 antibody


Western Blot analysis using IMPDH1 antibody (70R-2055)

IMPDH1 antibody (70R-2055) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPDH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IMPDH1 antibody (70R-2055) | IMPDH1 antibody (70R-2055) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors