Influenza Virus Ns1A Binding Protein antibody (70R-2152)

Rabbit polyclonal Influenza Virus Ns1A Binding Protein antibody raised against the N terminal of IVNS1ABP

Synonyms Polyclonal Influenza Virus Ns1A Binding Protein antibody, Anti-Influenza Virus Ns1A Binding Protein antibody, Swine Flu antibody, Influenza A nuclear antibody, Flu A antibody, Influenza Ns1A Binding Protein antibody, H1N1 antibody, Influenza ABP antibody, Flu A H1N1 antibody, IVNS1ABP antibody
Specificity Influenza Virus Ns1A Binding Protein antibody was raised against the N terminal of IVNS1ABP
Cross Reactivity Human, Dog
Applications IHC, WB
Immunogen Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Assay Information Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody


Western blot analysis using Influenza Virus Ns1A Binding Protein antibody (70R-2152)

Recommended IVNS1ABP Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IVNS1ABP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using Influenza Virus Ns1A Binding Protein antibody (70R-2152) | Recommended IVNS1ABP Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using Influenza Virus Ns1A Binding Protein antibody (70R-2152) | Human Liver

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors